RAB27A polyclonal antibody View larger

RAB27A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB27A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about RAB27A polyclonal antibody

Brand: Abnova
Reference: PAB28415
Product name: RAB27A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RAB27A.
Isotype: IgG
Gene id: 5873
Gene name: RAB27A
Gene alias: GS2|HsT18676|MGC117246|RAB27|RAM
Gene description: RAB27A, member RAS oncogene family
Immunogen: Recombinant protein corresponding to human RAB27A.
Immunogen sequence/protein sequence: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Protein accession: P51159
Form: Liquid
Recommend dilutions: Western Blot (1:250-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28415-48-4-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human stomach with RAB27A polyclonal antibody (Cat # PAB28415) shows strong cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RAB27A polyclonal antibody now

Add to cart