TAP2 polyclonal antibody View larger

TAP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TAP2 polyclonal antibody

Brand: Abnova
Reference: PAB28412
Product name: TAP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TAP2.
Isotype: IgG
Gene id: 6891
Gene name: TAP2
Gene alias: ABC18|ABCB3|APT2|D6S217E|PSF2|RING11
Gene description: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Immunogen: Recombinant protein corresponding to human TAP2.
Immunogen sequence/protein sequence: GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
Protein accession: Q03519
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28412-48-5-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human tonsil with TAP2 polyclonal antibody (Cat # PAB28412) shows strong cytoplasmic positivity in cells in seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TAP2 polyclonal antibody now

Add to cart