CKB polyclonal antibody View larger

CKB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CKB polyclonal antibody

Brand: Abnova
Reference: PAB28405
Product name: CKB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CKB.
Isotype: IgG
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Immunogen: Recombinant protein corresponding to human CKB.
Immunogen sequence/protein sequence: VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: P12277
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28405-48-51-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human cerebral cortex with CKB polyclonal antibody (Cat # PAB28405) shows distinct cytoplasmic positivity in a subset of glial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CKB polyclonal antibody now

Add to cart