MPST polyclonal antibody View larger

MPST polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPST polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about MPST polyclonal antibody

Brand: Abnova
Reference: PAB28403
Product name: MPST polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MPST.
Isotype: IgG
Gene id: 4357
Gene name: MPST
Gene alias: MGC24539|MST|TST2
Gene description: mercaptopyruvate sulfurtransferase
Immunogen: Recombinant protein corresponding to human MPST.
Immunogen sequence/protein sequence: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Protein accession: P25325
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28403-48-I6-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with MPST polyclonal antibody (Cat # PAB28403) shows strong cytoplasmic positivity in glandular cells.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MPST polyclonal antibody now

Add to cart