Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB28401 |
Product name: | PLOD3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant PLOD3. |
Isotype: | IgG |
Gene id: | 8985 |
Gene name: | PLOD3 |
Gene alias: | LH3 |
Gene description: | procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 |
Immunogen: | Recombinant protein corresponding to human PLOD3. |
Immunogen sequence/protein sequence: | FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL |
Protein accession: | O60568 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:100-1:250) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4 °C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human appendix with PLOD3 polyclonal antibody (Cat # PAB28401) shows moderate cytoplasmic positivity in glandular cells. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |