DGCR14 polyclonal antibody View larger

DGCR14 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DGCR14 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about DGCR14 polyclonal antibody

Brand: Abnova
Reference: PAB28397
Product name: DGCR14 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DGCR14.
Isotype: IgG
Gene id: 8220
Gene name: DGCR14
Gene alias: DGCR13|DGS-H|DGS-I|DGSH|DGSI|ES2|Es2el
Gene description: DiGeorge syndrome critical region gene 14
Immunogen: Recombinant protein corresponding to human DGCR14.
Immunogen sequence/protein sequence: ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV
Protein accession: F8WEF8
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28397-48-3-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human heart muscle with DGCR14 polyclonal antibody (Cat # PAB28397) shows moderate nuclear positivity in myocytes.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DGCR14 polyclonal antibody now

Add to cart