AGT polyclonal antibody View larger

AGT polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGT polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about AGT polyclonal antibody

Brand: Abnova
Reference: PAB28390
Product name: AGT polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AGT.
Isotype: IgG
Gene id: 183
Gene name: AGT
Gene alias: ANHU|FLJ92595|FLJ97926|SERPINA8
Gene description: angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
Immunogen: Recombinant protein corresponding to amino acids of human AGT.
Immunogen sequence/protein sequence: PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQG
Protein accession: P01019
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28390-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with AGT polyclonal antibody (Cat # PAB28390) shows moderate cytoplasmic positivity in hepatocytes.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AGT polyclonal antibody now

Add to cart