C1R polyclonal antibody View larger

C1R polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1R polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about C1R polyclonal antibody

Brand: Abnova
Reference: PAB28388
Product name: C1R polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C1R.
Isotype: IgG
Gene id: 715
Gene name: C1R
Gene alias: -
Gene description: complement component 1, r subcomponent
Immunogen: Recombinant protein corresponding to amino acids of human C1R.
Immunogen sequence/protein sequence: PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC
Protein accession: D3DUT5
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28388-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with C1R polyclonal antibody (Cat # PAB28388) shows cytoplasmic positivity in bone marrow poietic cells at 1:50-1:200 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1R polyclonal antibody now

Add to cart