IFNGR2 polyclonal antibody View larger

IFNGR2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNGR2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about IFNGR2 polyclonal antibody

Brand: Abnova
Reference: PAB28384
Product name: IFNGR2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IFNGR2.
Isotype: IgG
Gene id: 3460
Gene name: IFNGR2
Gene alias: AF-1|IFGR2|IFNGT1
Gene description: interferon gamma receptor 2 (interferon gamma transducer 1)
Immunogen: Recombinant protein corresponding to amino acids of human IFNGR2.
Immunogen sequence/protein sequence: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Protein accession: B5MCZ0
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28384-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with IFNGR2 polyclonal antibody (Cat # PAB28384) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFNGR2 polyclonal antibody now

Add to cart