Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB28382 |
Product name: | LUM polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant LUM. |
Isotype: | IgG |
Gene id: | 4060 |
Gene name: | LUM |
Gene alias: | LDC|SLRR2D |
Gene description: | lumican |
Immunogen: | Recombinant protein corresponding to amino acids of human LUM. |
Immunogen sequence/protein sequence: | DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF |
Protein accession: | P51884 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human prostate with LUM polyclonal antibody (Cat # PAB28382) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | The significance of lumican expression in ovarian cancer drug-resistant cell lines.Klejewski A, Sterzy?ska K, Wojtowicz K, ?wierczewska M, Partyka M, Br?zert M, Nowicki M, Zabel M, Januchowski R. Oncotarget. 2017 Aug 10;8(43):74466-74478. |