UBE2L3 polyclonal antibody View larger

UBE2L3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2L3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about UBE2L3 polyclonal antibody

Brand: Abnova
Reference: PAB28318
Product name: UBE2L3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UBE2L3.
Isotype: IgG
Gene id: 7332
Gene name: UBE2L3
Gene alias: E2-F1|L-UBC|UBCH7|UbcM4
Gene description: ubiquitin-conjugating enzyme E2L 3
Immunogen: Recombinant protein corresponding to amino acids of recombinant UBE2L3.
Immunogen sequence/protein sequence: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK
Protein accession: P68036
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28318-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with UBE2L3 polyclonal antibody (Cat # PAB28318).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy UBE2L3 polyclonal antibody now

Add to cart