ARL6IP1 polyclonal antibody View larger

ARL6IP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ARL6IP1 polyclonal antibody

Brand: Abnova
Reference: PAB28311
Product name: ARL6IP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARL6IP1.
Isotype: IgG
Gene id: 23204
Gene name: ARL6IP1
Gene alias: AIP1|ARL6IP|ARMER|KIAA0069
Gene description: ADP-ribosylation factor-like 6 interacting protein 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant ARL6IP1.
Immunogen sequence/protein sequence: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Protein accession: Q15041
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28311-51-89-1.jpg
Application image note: Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with ARL6IP1 polyclonal antibody (Cat # PAB28311).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARL6IP1 polyclonal antibody now

Add to cart