CYP2D6 polyclonal antibody View larger

CYP2D6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP2D6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CYP2D6 polyclonal antibody

Brand: Abnova
Reference: PAB28309
Product name: CYP2D6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CYP2D6.
Isotype: IgG
Gene id: 1565
Gene name: CYP2D6
Gene alias: CPD6|CYP2D|CYP2D@|CYP2DL1|MGC120389|MGC120390|P450-DB1|P450C2D|P450DB1
Gene description: cytochrome P450, family 2, subfamily D, polypeptide 6
Immunogen: Recombinant protein corresponding to amino acids of recombinant CYP2D6.
Immunogen sequence/protein sequence: EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Protein accession: P10635
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28309-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with CYP2D6 polyclonal antibody ( Cat # PAB28309 ) shows strong cytoplasmic positivity in hepatocytes at 1:200 - 1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CYP2D6 polyclonal antibody now

Add to cart