SGMS1 polyclonal antibody View larger

SGMS1 polyclonal antibody

PAB28308_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SGMS1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about SGMS1 polyclonal antibody

Brand: Abnova
Reference: PAB28308
Product name: SGMS1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SGMS1.
Isotype: IgG
Gene id: 259230
Gene name: SGMS1
Gene alias: MGC17342|MOB|MOB1|SMS1|TMEM23
Gene description: sphingomyelin synthase 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant SGMS1.
Immunogen sequence/protein sequence: ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
Protein accession: Q86VZ5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28308-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with SGMS1 polyclonal antibody (Cat # PAB28308).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SGMS1 polyclonal antibody now

Add to cart