ZMIZ1 polyclonal antibody View larger

ZMIZ1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZMIZ1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ZMIZ1 polyclonal antibody

Brand: Abnova
Reference: PAB28307
Product name: ZMIZ1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZMIZ1.
Isotype: IgG
Gene id: 57178
Gene name: ZMIZ1
Gene alias: FLJ13541|KIAA1224|MIZ|RAI17|Zimp10|hZIMP10
Gene description: zinc finger, MIZ-type containing 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant ZMIZ1.
Immunogen sequence/protein sequence: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT
Protein accession: Q9ULJ6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28307-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with ZMIZ1 polyclonal antibody ( Cat # PAB28307 ) shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZMIZ1 polyclonal antibody now

Add to cart