Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | PAB28293 |
Product name: | HSPBAP1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant HSPBAP1. |
Isotype: | IgG |
Gene id: | 79663 |
Gene name: | HSPBAP1 |
Gene alias: | FLJ22623|FLJ39386|PASS1 |
Gene description: | HSPB (heat shock 27kDa) associated protein 1 |
Immunogen: | Recombinant protein corresponding to amino acids of recombinant HSPBAP1. |
Immunogen sequence/protein sequence: | LQQPAIFCNMVFDWPARHWNAKYLSQVLHGKQIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQ |
Protein accession: | Q96EW2 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:10-1:20) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with HSPBAP1 polyclonal antibody (Cat # PAB28293). |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |