ESRRG polyclonal antibody View larger

ESRRG polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESRRG polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ESRRG polyclonal antibody

Brand: Abnova
Reference: PAB28291
Product name: ESRRG polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ESRRG.
Isotype: IgG
Gene id: 2104
Gene name: ESRRG
Gene alias: DKFZp781L1617|ERR3|FLJ16023|KIAA0832|NR3B3
Gene description: estrogen-related receptor gamma
Immunogen: Recombinant protein corresponding to amino acids of recombinant ESRRG.
Immunogen sequence/protein sequence: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Protein accession: P62508
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28291-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with ESRRG polyclonal antibody ( Cat # PAB28291 ) shows moderate cytoplasmic positivity in cells in tubules at 1:20 - 1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ESRRG polyclonal antibody now

Add to cart