C1orf216 polyclonal antibody View larger

C1orf216 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1orf216 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C1orf216 polyclonal antibody

Brand: Abnova
Reference: PAB28269
Product name: C1orf216 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C1orf216.
Isotype: IgG
Gene id: 127703
Gene name: C1orf216
Gene alias: FLJ38984
Gene description: chromosome 1 open reading frame 216
Immunogen: Recombinant protein corresponding to amino acids of recombinant C1orf216.
Immunogen sequence/protein sequence: MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28269-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with C1orf216 polyclonal antibody (Cat # PAB28269) shows strong positivity in endothelial cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C1orf216 polyclonal antibody now

Add to cart