FAM82B polyclonal antibody View larger

FAM82B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM82B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about FAM82B polyclonal antibody

Brand: Abnova
Reference: PAB28261
Product name: FAM82B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM82B.
Isotype: IgG
Gene id: 51115
Gene name: FAM82B
Gene alias: CGI-90|FLJ20665|RMD-1|RMD1
Gene description: family with sequence similarity 82, member B
Immunogen: Recombinant protein corresponding to amino acids of recombinant FAM82B.
Immunogen sequence/protein sequence: RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28261-51-89-1.jpg
Application image note: Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with FAM82B polyclonal antibody (Cat # PAB28261) at 1:100 - 1:250 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FAM82B polyclonal antibody now

Add to cart