ANKS4B polyclonal antibody View larger

ANKS4B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKS4B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ANKS4B polyclonal antibody

Brand: Abnova
Reference: PAB28127
Product name: ANKS4B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ANKS4B.
Isotype: IgG
Gene id: 257629
Gene name: ANKS4B
Gene alias: FLJ38819|HARP|MGC133380|MGC133381
Gene description: ankyrin repeat and sterile alpha motif domain containing 4B
Immunogen: Recombinant protein corresponding to amino acids of recombinant ANKS4B.
Immunogen sequence/protein sequence: VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP
Protein accession: Q8N8V4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28127-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with ANKS4B polyclonal antibody (Cat # PAB28127) shows strong membranous positivity in cells in tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ANKS4B polyclonal antibody now

Add to cart