CLIP4 polyclonal antibody View larger

CLIP4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLIP4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about CLIP4 polyclonal antibody

Brand: Abnova
Reference: PAB28113
Product name: CLIP4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CLIP4.
Isotype: IgG
Gene id: 79745
Gene name: CLIP4
Gene alias: FLJ21069|FLJ32705|RSNL2
Gene description: CAP-GLY domain containing linker protein family, member 4
Immunogen: Recombinant protein corresponding to amino acids of recombinant CLIP4.
Immunogen sequence/protein sequence: TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
Protein accession: Q8N3C7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28113-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with CLIP4 polyclonal antibody (Cat # PAB28113) at 1-4 ug/mL dilution shows positivity in vesicles.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CLIP4 polyclonal antibody now

Add to cart