CHCHD2 polyclonal antibody View larger

CHCHD2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHCHD2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about CHCHD2 polyclonal antibody

Brand: Abnova
Reference: PAB28031
Product name: CHCHD2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CHCHD2
Isotype: IgG
Gene id: 51142
Gene name: CHCHD2
Gene alias: C7orf17
Gene description: coiled-coil-helix-coiled-coil-helix domain containing 2
Immunogen: Recombinant protein corresponding to amino acids of human CHCHD2
Immunogen sequence/protein sequence: YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50 - 1:200)
Western Blot (1:250 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28031-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with CHCHD2 polyclonal antibody ( Cat # PAB28031 ) shows strong cytoplasmic positivity in glandular cells at 1:50 - 1:200 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CHCHD2 polyclonal antibody now

Add to cart