FYB polyclonal antibody View larger

FYB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FYB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FYB polyclonal antibody

Brand: Abnova
Reference: PAB28030
Product name: FYB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FYB
Isotype: IgG
Gene id: 2533
Gene name: FYB
Gene alias: ADAP|PRO0823|SLAP-130
Gene description: FYN binding protein (FYB-120/130)
Immunogen: Recombinant protein corresponding to amino acids of human FYB
Immunogen sequence/protein sequence: RPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28030-48-5-1.jpg
Application image note: Immunohistochemical staining of human tonsil with FYB polyclonal antibody ( Cat # PAB28030 ) shows strong cytoplasmic positivity at 1:50 - 1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FYB polyclonal antibody now

Add to cart