ZNF618 polyclonal antibody View larger

ZNF618 polyclonal antibody

PAB28026_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF618 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ZNF618 polyclonal antibody

Brand: Abnova
Reference: PAB28026
Product name: ZNF618 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF618
Isotype: IgG
Gene id: 114991
Gene name: ZNF618
Gene alias: FP13169
Gene description: zinc finger protein 618
Immunogen: Recombinant protein corresponding to amino acids of human ZNF618
Immunogen sequence/protein sequence: VIELSNESQPTLQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWAEEA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10 - 1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28026-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with ZNF618 polyclonal antibody ( Cat # PAB28026 ) shows strong cytoplasmic and membranous positivity in glandular cells at 1:10 - 1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZNF618 polyclonal antibody now

Add to cart