VMO1 polyclonal antibody View larger

VMO1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VMO1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about VMO1 polyclonal antibody

Brand: Abnova
Reference: PAB28025
Product name: VMO1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VMO1
Isotype: IgG
Gene id: 284013
Gene name: VMO1
Gene alias: ERGA6350|MGC125880|MGC125881|PRO21055
Gene description: vitelline membrane outer layer 1 homolog (chicken)
Immunogen: Recombinant protein corresponding to amino acids of human VMO1
Immunogen sequence/protein sequence: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28025-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with VMO1 polyclonal antibody ( Cat # PAB28025 ) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50 - 1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy VMO1 polyclonal antibody now

Add to cart