MRPS24 polyclonal antibody View larger

MRPS24 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS24 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about MRPS24 polyclonal antibody

Brand: Abnova
Reference: PAB28022
Product name: MRPS24 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MRPS24
Isotype: IgG
Gene id: 64951
Gene name: MRPS24
Gene alias: HSPC335|MRP-S24
Gene description: mitochondrial ribosomal protein S24
Immunogen: Recombinant protein corresponding to amino acids of human MRPS24
Immunogen sequence/protein sequence: GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28022-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with MRPS24 polyclonal antibody ( Cat # PAB28022 ) shows strong cytoplasmic positivity in goblet cells at 1:20 - 1:50 dilution.
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MRPS24 polyclonal antibody now

Add to cart