NXPH1 polyclonal antibody View larger

NXPH1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXPH1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about NXPH1 polyclonal antibody

Brand: Abnova
Reference: PAB28021
Product name: NXPH1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NXPH1
Isotype: IgG
Gene id: 30010
Gene name: NXPH1
Gene alias: NPH1|Nbla00697
Gene description: neurexophilin 1
Immunogen: Recombinant protein corresponding to amino acids of human NXPH1
Immunogen sequence/protein sequence: NLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGW
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28021-48-44-1.jpg
Application image note: Immunohistochemical staining of human smooth muscle with NXPH1 polyclonal antibody ( Cat # PAB28021 ) shows strong cytoplasmic positivity in smooth muscle cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NXPH1 polyclonal antibody now

Add to cart