UGT2A2 polyclonal antibody View larger

UGT2A2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGT2A2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about UGT2A2 polyclonal antibody

Brand: Abnova
Reference: PAB28013
Product name: UGT2A2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UGT2A2
Isotype: IgG
Gene id: 574537
Gene name: UGT2A2
Gene alias: -
Gene description: UDP glucuronosyltransferase 2 family, polypeptide A2
Immunogen: Recombinant protein corresponding to amino acids of human UGT2A2
Immunogen sequence/protein sequence: KEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28013-48-302-1.jpg
Application image note: Immunohistochemical staining of human nasopharynx with UGT2A2 polyclonal antibody ( Cat # PAB28013 ) shows moderate cytoplasmic positivity in respiratory epithelial cells at 1:20 - 1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy UGT2A2 polyclonal antibody now

Add to cart