ZNF512B polyclonal antibody View larger

ZNF512B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF512B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ZNF512B polyclonal antibody

Brand: Abnova
Reference: PAB28007
Product name: ZNF512B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF512B
Isotype: IgG
Gene id: 57473
Gene name: ZNF512B
Gene alias: GM632|KIAA1196|MGC149845|MGC149846
Gene description: zinc finger protein 512B
Immunogen: Recombinant protein corresponding to amino acids of human ZNF512B
Immunogen sequence/protein sequence: FPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVT
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200 - 1:500)
Immunofluorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28007-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with ZNF512B polyclonal antibody ( Cat # PAB28007 ) shows strong cytoplasmic positivity in urothelial cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ZNF512B polyclonal antibody now

Add to cart