C3orf33 polyclonal antibody View larger

C3orf33 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C3orf33 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about C3orf33 polyclonal antibody

Brand: Abnova
Reference: PAB27996
Product name: C3orf33 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C3orf33
Isotype: IgG
Gene id: 285315
Gene name: C3orf33
Gene alias: FLJ31139
Gene description: chromosome 3 open reading frame 33
Immunogen: Recombinant protein corresponding to amino acids of human C3orf33
Immunogen sequence/protein sequence: RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27996-48-72-1.jpg
Application image note: Immunohistochemical staining of human vulva/anal skin with C3orf33 polyclonal antibody ( Cat # PAB27996 ) shows strong nuclear positivity in squamous epithelial cells at 1:20 - 1:50 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy C3orf33 polyclonal antibody now

Add to cart