C5orf42 polyclonal antibody View larger

C5orf42 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C5orf42 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C5orf42 polyclonal antibody

Brand: Abnova
Reference: PAB27995
Product name: C5orf42 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C5orf42
Isotype: IgG
Gene id: 65250
Gene name: C5orf42
Gene alias: DKFZp686K02105|FLJ13231|FLJ21126
Gene description: chromosome 5 open reading frame 42
Immunogen: Recombinant protein corresponding to amino acids of human C5orf42
Immunogen sequence/protein sequence: IAENIEQDFPKPEMLDLHCDKIGPVDHIEFSSGPEFKKTLASKTISISEEVRFLTHMDEEDQSDKKETSEPEFSITE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27995-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with C5orf42 polyclonal antibody ( Cat # PAB27995 ) shows strong cytoplasmic positivity in exocrine glandular cells in granular pattern at 1:500 - 1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C5orf42 polyclonal antibody now

Add to cart