DENND1C polyclonal antibody View larger

DENND1C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DENND1C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about DENND1C polyclonal antibody

Brand: Abnova
Reference: PAB27942
Product name: DENND1C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DENND1C.
Isotype: IgG
Gene id: 79958
Gene name: DENND1C
Gene alias: FAM31C|FLJ22757
Gene description: DENN/MADD domain containing 1C
Immunogen: Recombinant protein corresponding to amino acids of human DENND1C.
Immunogen sequence/protein sequence: PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:2500-1:5000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27942-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with DENND1C polyclonal antibody (Cat # PAB27942) shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells at 1:2500-1:5000 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DENND1C polyclonal antibody now

Add to cart