SHQ1 polyclonal antibody View larger

SHQ1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SHQ1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SHQ1 polyclonal antibody

Brand: Abnova
Reference: PAB27941
Product name: SHQ1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SHQ1.
Isotype: IgG
Gene id: 55164
Gene name: SHQ1
Gene alias: DKFZp686H07226|FLJ10539
Gene description: SHQ1 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human SHQ1.
Immunogen sequence/protein sequence: ELKDSPSETVSSLQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTAVNRSNIQERDGCQTPNN
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27941-48-307-1.jpg
Application image note: Immunohistochemical staining of human vagina with SHQ1 polyclonal antibody (Cat # PAB27941) shows strong cytoplasmic and membranous positivity in superficial squamous epithelial cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SHQ1 polyclonal antibody now

Add to cart