B9D2 polyclonal antibody View larger

B9D2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B9D2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about B9D2 polyclonal antibody

Brand: Abnova
Reference: PAB27926
Product name: B9D2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant B9D2.
Isotype: IgG
Gene id: 80776
Gene name: B9D2
Gene alias: ICIS-1|MGC4093
Gene description: B9 protein domain 2
Immunogen: Recombinant protein corresponding to amino acids of human B9D2.
Immunogen sequence/protein sequence: WSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYG
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27926-48-303-1.jpg
Application image note: Immunohistochemical staining of human fallopian tube with B9D2 polyclonal antibody (Cat # PAB27926) shows distinct positivity in ciliated cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy B9D2 polyclonal antibody now

Add to cart