DHX34 polyclonal antibody View larger

DHX34 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHX34 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DHX34 polyclonal antibody

Brand: Abnova
Reference: PAB27923
Product name: DHX34 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DHX34.
Isotype: IgG
Gene id: 9704
Gene name: DHX34
Gene alias: DDX34|HRH1|KIAA0134
Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 34
Immunogen: Recombinant protein corresponding to amino acids of human DHX34.
Immunogen sequence/protein sequence: TYDPRYRINLSVLGPATRGSQGLGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27923-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach, upper with DHX34 polyclonal antibody (Cat # PAB27923) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DHX34 polyclonal antibody now

Add to cart