LSM7 polyclonal antibody View larger

LSM7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LSM7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about LSM7 polyclonal antibody

Brand: Abnova
Reference: PAB27913
Product name: LSM7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LSM7.
Isotype: IgG
Gene id: 51690
Gene name: LSM7
Gene alias: YNL147W
Gene description: LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human LSM7.
Immunogen sequence/protein sequence: RSGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQD
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27913-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with LSM7 polyclonal antibody (Cat # PAB27913) shows strong cytoplasmic positivity in cells in seminiferus duct.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy LSM7 polyclonal antibody now

Add to cart