CLN5 polyclonal antibody View larger

CLN5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLN5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CLN5 polyclonal antibody

Brand: Abnova
Reference: PAB27910
Product name: CLN5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CLN5.
Isotype: IgG
Gene id: 1203
Gene name: CLN5
Gene alias: FLJ90628|NCL
Gene description: ceroid-lipofuscinosis, neuronal 5
Immunogen: Recombinant protein corresponding to amino acids of human CLN5.
Immunogen sequence/protein sequence: TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27910-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with CLN5 polyclonal antibody (Cat # PAB27910) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLN5 polyclonal antibody now

Add to cart