TTLL9 polyclonal antibody View larger

TTLL9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TTLL9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TTLL9 polyclonal antibody

Brand: Abnova
Reference: PAB27909
Product name: TTLL9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TTLL9.
Isotype: IgG
Gene id: 164395
Gene name: TTLL9
Gene alias: C20orf125|MGC120486|MGC120487|dJ310O13.1
Gene description: tubulin tyrosine ligase-like family, member 9
Immunogen: Recombinant protein corresponding to amino acids of human TTLL9.
Immunogen sequence/protein sequence: GITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27909-48-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with TTLL9 polyclonal antibody (Cat # PAB27909) shows strong nuclear positivity in squamous epithelial cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TTLL9 polyclonal antibody now

Add to cart