CHMP4B polyclonal antibody View larger

CHMP4B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHMP4B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CHMP4B polyclonal antibody

Brand: Abnova
Reference: PAB27902
Product name: CHMP4B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CHMP4B.
Isotype: IgG
Gene id: 128866
Gene name: CHMP4B
Gene alias: C20orf178|CHMP4A|CTPP3|SNF7|SNF7-2|Shax1|dJ553F4.4
Gene description: chromatin modifying protein 4B
Immunogen: Recombinant protein corresponding to amino acids of human CHMP4B.
Immunogen sequence/protein sequence: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27902-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with CHMP4B polyclonal antibody (Cat # PAB27902) shows strong granular cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CHMP4B polyclonal antibody now

Add to cart