APOL5 polyclonal antibody View larger

APOL5 polyclonal antibody

PAB27891_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOL5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about APOL5 polyclonal antibody

Brand: Abnova
Reference: PAB27891
Product name: APOL5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant APOL5.
Isotype: IgG
Gene id: 80831
Gene name: APOL5
Gene alias: APOL-V|APOLV
Gene description: apolipoprotein L, 5
Immunogen: Recombinant protein corresponding to amino acids of human APOL5.
Immunogen sequence/protein sequence: AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27891-48-37-1.jpg
Application image note: Immunohistochemical staining of human gallbladder with APOL5 polyclonal antibody (Cat # PAB27891) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy APOL5 polyclonal antibody now

Add to cart