OSBPL1A polyclonal antibody View larger

OSBPL1A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSBPL1A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about OSBPL1A polyclonal antibody

Brand: Abnova
Reference: PAB27889
Product name: OSBPL1A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant OSBPL1A.
Isotype: IgG
Gene id: 114876
Gene name: OSBPL1A
Gene alias: FLJ10217|ORP-1|ORP1|OSBPL1B
Gene description: oxysterol binding protein-like 1A
Immunogen: Recombinant protein corresponding to amino acids of human OSBPL1A.
Immunogen sequence/protein sequence: VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27889-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with OSBPL1A polyclonal antibody (Cat # PAB27889) shows strong cytoplasmic and nuclear positivity in Purkinje cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy OSBPL1A polyclonal antibody now

Add to cart