ZNF609 polyclonal antibody View larger

ZNF609 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF609 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ZNF609 polyclonal antibody

Brand: Abnova
Reference: PAB27880
Product name: ZNF609 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF609.
Isotype: IgG
Gene id: 23060
Gene name: ZNF609
Gene alias: KIAA0295|MGC164858
Gene description: zinc finger protein 609
Immunogen: Recombinant protein corresponding to amino acids of human ZNF609.
Immunogen sequence/protein sequence: DGEGKVDSVKSKDAEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYSPSYAQSSPGALNPSSQAGVESQALKTKRDEEPESIEGKVKNDICEEKKPE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27880-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with ZNF609 polyclonal antibody (Cat # PAB27880) shows moderate cytoplasmic, membranous and nuclear positivity in glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ZNF609 polyclonal antibody now

Add to cart