GOLGA3 polyclonal antibody View larger

GOLGA3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GOLGA3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about GOLGA3 polyclonal antibody

Brand: Abnova
Reference: PAB27868
Product name: GOLGA3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GOLGA3.
Isotype: IgG
Gene id: 2802
Gene name: GOLGA3
Gene alias: GCP170|MEA-2
Gene description: golgi autoantigen, golgin subfamily a, 3
Immunogen: Recombinant protein corresponding to amino acids of human GOLGA3.
Immunogen sequence/protein sequence: TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27868-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with GOLGA3 polyclonal antibody (Cat # PAB27868) shows strong cytoplasmic positivity in neuronal cells at 1:500-1:1000 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy GOLGA3 polyclonal antibody now

Add to cart