KDELC2 polyclonal antibody View larger

KDELC2 polyclonal antibody

PAB27866_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KDELC2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about KDELC2 polyclonal antibody

Brand: Abnova
Reference: PAB27866
Product name: KDELC2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KDELC2.
Isotype: IgG
Gene id: 143888
Gene name: KDELC2
Gene alias: MGC33424
Gene description: KDEL (Lys-Asp-Glu-Leu) containing 2
Immunogen: Recombinant protein corresponding to amino acids of human KDELC2.
Immunogen sequence/protein sequence: YHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27866-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with KDELC2 polyclonal antibody (Cat # PAB27866) shows strong cytoplasmic positivity in trophoblastic cells at 1:500-1:1000 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KDELC2 polyclonal antibody now

Add to cart