GRINA polyclonal antibody View larger

GRINA polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRINA polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GRINA polyclonal antibody

Brand: Abnova
Reference: PAB27854
Product name: GRINA polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GRINA.
Isotype: IgG
Gene id: 2907
Gene name: GRINA
Gene alias: HNRGW|MGC99687|NMDARA1|TMBIM3
Gene description: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)
Immunogen: Recombinant protein corresponding to amino acids of human GRINA.
Immunogen sequence/protein sequence: PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27854-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with GRINA polyclonal antibody (Cat # PAB27854) shows moderate cytoplasmic, membrane and nucleolar positivity in urothelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GRINA polyclonal antibody now

Add to cart