PGAM5 polyclonal antibody View larger

PGAM5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGAM5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about PGAM5 polyclonal antibody

Brand: Abnova
Reference: PAB27853
Product name: PGAM5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PGAM5.
Isotype: IgG
Gene id: 192111
Gene name: PGAM5
Gene alias: BXLBv68|MGC5352
Gene description: phosphoglycerate mutase family member 5
Immunogen: Recombinant protein corresponding to amino acids of human PGAM5.
Immunogen sequence/protein sequence: PGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPP
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27853-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with PGAM5 polyclonal antibody (Cat # PAB27853) shows strong cytoplasmic positivity in granular pattern in exocrine pancreas.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PGAM5 polyclonal antibody now

Add to cart