ARHGAP18 polyclonal antibody View larger

ARHGAP18 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGAP18 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ARHGAP18 polyclonal antibody

Brand: Abnova
Reference: PAB27845
Product name: ARHGAP18 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARHGAP18.
Isotype: IgG
Gene id: 93663
Gene name: ARHGAP18
Gene alias: FLJ25728|MGC126757|MGC138145|MacGAP|bA307O14.2
Gene description: Rho GTPase activating protein 18
Immunogen: Recombinant protein corresponding to amino acids of human ARHGAP18.
Immunogen sequence/protein sequence: STTIKVMEKPPFDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESI
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27845-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with ARHGAP18 polyclonal antibody (Cat # PAB27845) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ARHGAP18 polyclonal antibody now

Add to cart