WIPF3 polyclonal antibody View larger

WIPF3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WIPF3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about WIPF3 polyclonal antibody

Brand: Abnova
Reference: PAB27513
Product name: WIPF3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WIPF3.
Isotype: IgG
Gene id: 644150
Gene name: WIPF3
Gene alias: CR16|FLJ36931
Gene description: WAS/WASL interacting protein family, member 3
Immunogen: Recombinant protein corresponding to amino acids of human WIPF3.
Immunogen sequence/protein sequence: QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27513-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with WIPF3 polyclonal antibody (Cat # PAB27513) shows strong granular cytoplasmic positivity in cells in seminiferus ducts at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy WIPF3 polyclonal antibody now

Add to cart