TBC1D30 polyclonal antibody View larger

TBC1D30 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBC1D30 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TBC1D30 polyclonal antibody

Brand: Abnova
Reference: PAB27510
Product name: TBC1D30 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TBC1D30.
Isotype: IgG
Gene id: 23329
Gene name: TBC1D30
Gene alias: KIAA0984
Gene description: TBC1 domain family, member 30
Immunogen: Recombinant protein corresponding to amino acids of human TBC1D30.
Immunogen sequence/protein sequence: CLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQYSRIKKKQQQQVH
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB27510-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with TBC1D30 polyclonal antibody (Cat # PAB27510) shows strong cytoplasmic positivity in cells in tubules.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TBC1D30 polyclonal antibody now

Add to cart