TGM4 polyclonal antibody View larger

TGM4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGM4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TGM4 polyclonal antibody

Brand: Abnova
Reference: PAB25811
Product name: TGM4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TGM4.
Isotype: IgG
Gene id: 7047
Gene name: TGM4
Gene alias: FLJ26776|TGP|hTGP
Gene description: transglutaminase 4 (prostate)
Immunogen: Recombinant protein corresponding to human TGM4.
Immunogen sequence/protein sequence: SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA
Form: Liquid
Concentration: 0.05 mg/mL
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB25811-48-33-1.jpg
Application image note: Immunohistochemical staining of human liver with TGM4 polyclonal antibody (Cat # PAB25811) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TGM4 polyclonal antibody now

Add to cart